SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059069 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059069
Domain Number 1 Region: 319-369
Classification Level Classification E-value
Superfamily PH domain-like 0.000000234
Family Ran-binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059069   Gene: ENSXETG00000003053   Transcript: ENSXETT00000066097
Sequence length 386
Comment pep:known scaffold:JGI_4.2:GL173822.1:551:6369:1 gene:ENSXETG00000003053 transcript:ENSXETT00000066097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIADKELTDRNWDQEEEAEDAGTFSVASQEVMKTREIKKAKRRNLGSDGERGGAFKG
FKGLFSGTGASLPSFGNGSSXXXXXXXXXXXXXXXSTSLFINLKPASESKPTFGSAFTSR
PLLGAADKPLGTASTNGERALSTSGAALSKAGNSEYNKHLTSLNCSVRDWIVKHVNTNPL
CDLSPIFRDYEKHLSAIEQKYGASSDSGSESDGAAQTKTIPTLHSIKADPIATFSFGSKD
KAPGVPVKTPPDSKPQAAAPTFNFGQKVDSSTLSLIGSGGAPSFSFSTGASSLFGKSTGS
TASSSQESEPSSNTEGKGDGEEEEEPPKAVIQEVKEDDAFYSKKCKLFYKKDNEFKEKGV
GTLHLKPVENRLSSWCAPIPTWATYS
Download sequence
Identical sequences F6T5C1
ENSXETP00000059069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]