SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059090 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059090
Domain Number 1 Region: 346-699
Classification Level Classification E-value
Superfamily L domain-like 3.15e-51
Family Ngr ectodomain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 783-924
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.14e-41
Family Toll/Interleukin receptor TIR domain 0.0000191
Further Details:      
 
Domain Number 3 Region: 36-286
Classification Level Classification E-value
Superfamily L domain-like 3.32e-37
Family Ngr ectodomain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059090   Gene: ENSXETG00000032848   Transcript: ENSXETT00000061166
Sequence length 939
Comment pep:known scaffold:JGI_4.2:GL172845.1:1250983:1253799:1 gene:ENSXETG00000032848 transcript:ENSXETT00000061166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTDMAILLVALTFVVLLIPGLTSYGFRNCIQSSVIINSYNCIARGLTDVKSAVGDLPSDV
WYLNISYNNIQTLHQGSFGHMPFLRTLRLNHNQLQRLDPGAFENLTMLEKLHLSSNKISN
LSKEVFCGLQNVSWLFLDDNLLSSIHPEAFSHLTNLQNLNLSMNNLHNFEKVVQSIHPLQ
KLNTLMLCSNQISSLNHTHRLPSTLRWLFLCKNQLATLDCQQDFFLNISWLDLSYNNIAT
SSLQTMDLRKVIYLNVAFNGNFDILIFIKNPTVPINRIDYSGLNLNNDSKLKTMCRYLKG
FNINTLYLSGNKIKTLNRGTLTDCPLNKTLDLSRNRLKGLGCLEFMSKTNVENLIVEHNL
LKELINCSKKSHFPRLRHISFRYNRIWIVKGNAFHFAPNLQTLYLNINNIVFLERYSFSG
LGKLRELRLDNNLITDLYENSFANLTELRILNLRNNRVSVIFSKVFYNLGKLTTLDLGGN
KITQLKNQSFYGLRSLSKLYLDGNQIKEISRYVFSHVESTLLVLDLKSNHLRYNTTRETY
SPFLTLSKLYDLKLQAQQPYGLTAIPQGFFKGLKSLKALYLAQNRISSLSSDAFNELGQL
TYLSLAEDCNGIQKLPPGIFKNLKNLQILDLENICLQYMRMEVFSSLTNLKRLLLTKNAL
THINIKVFENMTQLKYLDLRKCPLSCTCNNAELQMWFKKGPVQIVLPYNLTCPANENSYF
HDFDTHVCDMEIKIKLFCSSFTSILLFIIIPIVYSKFYWMIKYNYFLFVAWLHERWKSEK
ELYKYDAFVSYNTHDEEWVYKIMLPVLETSALRLCLHHRDFQLGRDIIDNIVDSIHNSRK
TICVVSRSYLQSEWCSLEMQLASYKLFDEMRDVLVLILLDNIPDRELSTYHRMRKLMLKK
TYITWPTEPEAQQLFWAKVQEAVSGKRPSEGHQGIKIVK
Download sequence
Identical sequences F6SDW8
ENSXETP00000059090 ENSXETP00000059090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]