SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059101 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059101
Domain Number 1 Region: 211-486
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-84
Family Protein kinases, catalytic subunit 0.000000292
Further Details:      
 
Domain Number 2 Region: 119-257
Classification Level Classification E-value
Superfamily SH2 domain 6.87e-33
Family SH2 domain 0.00033
Further Details:      
 
Domain Number 3 Region: 53-140
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000654
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059101   Gene: ENSXETG00000033189   Transcript: ENSXETT00000064719
Sequence length 499
Comment pep:known_by_projection scaffold:JGI_4.2:GL173614.1:93440:100452:-1 gene:ENSXETG00000033189 transcript:ENSXETT00000064719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLLQENFPHIMESFLREQLNCLNCLWDRIWSPLSSNGGVSVITPHRDFNSTENIVTALY
NFDARCTEELTIEQGEELYKIRDDGEYIFARKLTGMESGLVPASYVAQSSLPGGHYTIQE
PWYMEVANRNEAERLLLSPPNAHGSFLVRPSDSTPGHYSLSDTVRNQDKVSHFRISVSAG
GEFYIQNERLFASIEELINFYKVNWKLIKSQLLQPCVWPYWVPRLQRDQWERPRSEFVLV
KELGAGNFGEVWEGLWNNKDKVAIKTFKQDNINESDFKKEVDALKTLCHRNLIQLYAVCS
VGEPVYIVTELMSKGSLQQFLRGNEGRYLTAANFMHIISQVAEGMAYLENNHVVHRDLAA
RNVLVGEELVCKVADFGLARILKDDLYLMHSSKNVPVKWTAPEALTHGKYSTKSDVWSYG
IVIYEVFILGQPPYQGMNNRQVLDKITSGYRLPKPDLCSPDIYNLMLECWQEKPNQRPSF
YDLVRKLTAIQSSLRIGTT
Download sequence
Identical sequences F7B4H0
ENSXETP00000059101 ENSXETP00000059101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]