SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059854 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059854
Domain Number 1 Region: 867-1154
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.2e-79
Family Complement components 0.0000254
Further Details:      
 
Domain Number 2 Region: 1238-1374
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.000000000144
Family Alpha-macroglobulin receptor domain 0.0036
Further Details:      
 
Domain Number 3 Region: 704-786
Classification Level Classification E-value
Superfamily E set domains 0.0000000392
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059854   Gene: ENSXETG00000031004   Transcript: ENSXETT00000064016
Sequence length 1403
Comment pep:known_by_projection scaffold:JGI_4.2:GL172904.1:62042:119098:-1 gene:ENSXETG00000031004 transcript:ENSXETT00000064016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIFLITSPMDIRPGVNLTLGIEMLQESPPLVKVVAQLQKDEHTLLEGESFFKRGGFGTLV
LPQLPLNSVNGKYELNVKGYSEENLIFFNKTSLEFKSKGFSVFIETNSVFYKPGQEVKIR
ILAFSFHMKPYKSTVDIYILDPQGNLIEQWLEEEMELGVVSQSLYLSDNPPLGDWTIKVK
LHQQLHYQTFTVMEQVLPRFEVLLNTTLYHSIKNPHLEGTVTAKYTYGMPVKGKLSVMLS
HNSIYKKKTNITKDFVINGCARFSFSNVELKELMKNADYGSNKVTGPVDIDVNVKESLTG
ITQNVTTSVFVIDKEYNIEFLDHPTVLKPMLNFTIRLQIVRYDGRKLTAEERDNEVAVTV
TQTNNSVELNATENESEDNVEMIQLTRYTVPKNGIICIEIPLLADIMHLYIKAEFLDAKN
NLFINDLFSSLNGTYIQIKKADQDLKVGTPYTLSVDGSFPLKDISYLVVSKGQIVAGGKG
NPKNITLNPENTWTPEVCLIVYHVANDGTVTNDVTAVSVQPIFENKVYISWNTTQARPAD
MVSLNVNVAEPNSLVVLSVIDKRVKLLGDRQEISTANVLKELKSYSTSHIQHYTNPSEVF
EMCNIGVMTDANIEVHDHFDRVYECSLFESGFDIPVQGALPVNFGSPRIRSLFPETWIWK
HLKTGSTTHMTLDLKVPDVITTWITSAYVISENFGFGMLAPPEQLEAFQPFFLSLNLPSY
VIRGEQFVLEVIVFNYLQKETEVSVTLEKSDAFEIQLAFVNASESQQSVSVPSQEGKIVF
FPIKPIHLGEIPITVKAISALASDAVTQKLQVKAEGVQQSHSQTLLLDLMGNKPKSISQT
LNFTFPPDVVSGSEKAFITVVGDHLGLSIRSIKSLIQMPYGCGEQNMIRFAPNIFIMEYL
SRTKQLNEDVAHKLISFIKNGYQRQLVYQREDGSFSAFGNKDPFGSTWLSAFVLQCFLKA
RPFILVDPVVLHNTLTWLLKHQRKNGEFWEPGTVIYSQIQGGHHSAITLTAYIMAALIEY
PGLKNSSQVAAATDYLESQMDEIISDNYTLSLVTYALSLVGRSKATEGLDLLNMRAEQEG
QLRFWRSSISSCQHPCSTDIVISAYALLSYVVQNRIAEGMAVMKWLSQQRSHLGGFSSTQ
DTIIALQAMSSFASVYTINKQILAITVDSHPLNSTATFQIDSNNRILLQTKQLAVQQQMN
LTVHAEGTGFAILQQFHTIYNLKNSVPGRYKSISSQDAFDLGITVLDNKDNLNVVSLNIC
TSFASEFKQVSVQVFFLKFFKTDSAALSCPSKIKKFVVAAFHSSFHFLDFFLNQTEVCID
IPATRDFKVGYTQEAFVHVIDYYDPGQRAIRSYNSEVMQQVSPCSFCNDDCNQCITGNHA
LRTEQTLFINYLFIILLLFQVML
Download sequence
Identical sequences F7EPU4
ENSXETP00000059854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]