SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000059880 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000059880
Domain Number 1 Region: 76-122
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000615
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 2 Region: 34-72
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000392
Family Somatomedin B domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000059880   Gene: ENSXETG00000030143   Transcript: ENSXETT00000066309
Sequence length 265
Comment pep:known_by_projection scaffold:JGI_4.2:GL172896.1:925476:944109:-1 gene:ENSXETG00000030143 transcript:ENSXETT00000066309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPCVWTLLLGLAVLIRSAEGGCMEAAKCCRGRDMNCTSQGWRLDRLYGTCFCDQACGLTG
DCCFDYSQACPVARACIVGEWSHWSGCADPCTPALRVRRRQVVQEPENGGNPCPALEEKA
GCLEYFTSQGTECAQSHVTAFITTFEYNKSRRRRALSPNWATEKEDAGYCVEFQVKSLSQ
DCLIESRPHARWMQYLREGYTVCVACQHPAMNMRNHRCYGDGRNANGNRLLHWEAVGNPQ
CQGTWKKLKEVESCSCPLVHSFIFT
Download sequence
Identical sequences F7EP32
ENSXETP00000059880 ENSXETP00000059880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]