SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060040 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060040
Domain Number 1 Region: 222-498
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-56
Family Protein kinases, catalytic subunit 0.0000000154
Further Details:      
 
Domain Number 2 Region: 120-261
Classification Level Classification E-value
Superfamily SH2 domain 2.85e-38
Family SH2 domain 0.0000091
Further Details:      
 
Domain Number 3 Region: 61-144
Classification Level Classification E-value
Superfamily SH3-domain 6.81e-21
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060040   Gene: ENSXETG00000005650   Transcript: ENSXETT00000065618
Sequence length 512
Comment pep:known scaffold:JGI_4.2:GL172719.1:2641378:2671639:1 gene:ENSXETG00000005650 transcript:ENSXETT00000065618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSRQSTPQDDMGKNNPVRKNDRTIYVPDPTAKLQRPVTCSPPLPWQQHKQREIEEQ
GNIVIALYPYQGIHQDDLTFKKGEKLKVIEEHGEWWKAKSLSSKKEGFIPSNYVARVNTL
ETEEWFFKDITRKDAERQLLAPGNNPGAFLIRESETSKGSYSLSIRDYDPKTGDVIKHYK
IRTLDNGGYYISPRITFTSICDMIQHYQKQADGLCRKLDKPCYSPKPQKPWDKDAWEIPR
ESIKLVKKLGAGQFGEVWMDFYLHSTMQGQKRLQPTVSSSASLQEPQIRKTLVGKMWHRP
YRLPTPSESSYVLTQSCAFLLTGSLLDFLKSDEGAKVILPKLIDFSAQIAEGMAYIEKKN
YIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTI
KSDVWSFGVLLYEIITTGKIPYPGKGMSNSDVMTALQRGYRMPRMENCPVELYDIMKECW
KEKAEERPTFDYLQSVLDDFYTATEAQYQQQP
Download sequence
Identical sequences F7EFA1
ENSXETP00000060040 ENSXETP00000060040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]