SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060587 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060587
Domain Number 1 Region: 351-578
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-32
Family YWTD domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 71-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000124
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 41-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 160-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 6 Region: 113-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060587   Gene: ENSXETG00000033501   Transcript: ENSXETT00000063038
Sequence length 642
Comment pep:novel scaffold:JGI_4.2:GL173022.1:87256:108637:-1 gene:ENSXETG00000033501 transcript:ENSXETT00000063038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLTNQFQCMDGACIPALWLCDGDKDCPNGEDEVSCSKKMACNGFQCKNGHCINSTSKCDG
HSDCADGSDEDLLICEHITCPSFKFHCRNRQCIAAELACNGQNDCTDGSDEVGCPPQQCS
PEEFRCGSLCLSRSLLCDGKIDCAGGLDELKEKCKGQSRLHCPTDEFECDGHCVPKAWRC
DGHPDCEDQSDEELCEVPTKKMTVLGCYSFSSTQLSLHCPGQLTCTDSADDHCDISRDMG
SPWSKVCNYIMVENTCCLTAFCISTLLMENDGLGCQCSYIIISYEVYHKCGFVGINNTHF
AIINEMQTLGFYSNVSVELAALFLKKQSLHFPLALCDGCCTGGAKALELEPFLLTFNSSE
IIKGDLTGERQENILFGLANITALTGDMWSSEIFWINGEDKNIYGTSVCQKKGRREILKQ
LGKATVLSLDWIYKLIFWINSETGTISVASLDGSKHRVLYRENISLPTAIAVNPLTGFII
WCDAGESPKIEKAAMDGSLRQPLVSVDIFRPMALTLDLKHSYVYWIDNELSKISSISMDG
QYRKVVFCSKELLAKPSGIAVFEERIFWSDLENQAIYSKQRRISANVTTVATVRNPAGLI
ILAREVQAFPSGINLCLELRADCPFLCVPSPLDPEHSTRFSC
Download sequence
Identical sequences F6XM04
ENSXETP00000060587 ENSXETP00000060587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]