SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060780 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060780
Domain Number 1 Region: 138-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-77
Family Nuclear receptor ligand-binding domain 0.000000378
Further Details:      
 
Domain Number 2 Region: 34-118
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-28
Family Nuclear receptor 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060780   Gene: ENSXETG00000018029   Transcript: ENSXETT00000064733
Sequence length 442
Comment pep:known scaffold:JGI_4.2:GL173328.1:288898:302698:-1 gene:ENSXETG00000018029 transcript:ENSXETT00000064733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVQEAVVLEEEEEEEDASNSCGTGEDEDDGEPKICRACGDRATGYHFNAMTCEGCKGF
FRRAMKRKLQLSCPFQNSCVINKSNRRHCQACRLKKCLDIGMRKELIMSDEAVEQRRALI
KRKQRLAESPPEPPGTSLTPEQQHFVTELAGAHTKTFDFNFSSFKNFRRPLNFNSSLASF
LSLSYVSMVCYLGNLIMHIVTMPLVSMVTYCCLRARRASPIKRSSDPTQDPDDEPQATSS
GAFLMLPHISDLITYMIKGVISFAKMLPYFKSLNIEDQIALLKGSVVEVCVIRFNTMFVP
ETNSWECGPITYNTEDMTMAGFRQLFLEPLLRMHRMMRKLNLHNEEYALMAAMALFASDR
PGVQDCKKIQNLQEHIALMLKRYIECQRPLSPQNRLLYPKIMECLTELRTVNDIHSKQLL
EIWDIQPDATPLLREVFGSHND
Download sequence
Identical sequences F6XJZ8
ENSXETP00000060780 ENSXETP00000060780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]