SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061042 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061042
Domain Number 1 Region: 6-157
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.09e-53
Family TRADD, N-terminal domain 0.0000291
Further Details:      
 
Domain Number 2 Region: 204-299
Classification Level Classification E-value
Superfamily DEATH domain 1.74e-17
Family DEATH domain, DD 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061042   Gene: ENSXETG00000031794   Transcript: ENSXETT00000062823
Sequence length 303
Comment pep:known_by_projection scaffold:JGI_4.2:GL172906.1:585179:589073:-1 gene:ENSXETG00000031794 transcript:ENSXETT00000062823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSSMWVGSVYLYIKSDEVSLPRKYTDQKALIYEALRSAISESTGGCRDSIEILKIHS
SDQQLILYLKFCGLEPCQIFLKDYKERKLQMQIQNKLENCFSVAQLPIFTELKIDTGEMD
SLLEKEEQCLKYISQMKPTIQKDDEFAEIDERLKSLKLVPPSALDSDLSSQNSSQCSLPL
SLHSNRNSHIEGSTFYFQGEEFVDRPLTSTHIQHFAKSVGRNWKLVGRSLGKTCRALNDT
AIENLAYEFDREGRYEQAYQLLRLFKDSEGKKATVQRLVQALEENGLNSIAFDLLSLNEN
GLE
Download sequence
Identical sequences F6YLU1
XP_002937214.1.99540 XP_004913591.1.99540 XP_012817698.1.99540 XP_012817699.1.99540 ENSXETP00000061042 gi|301615521|gb|XP_002937214| ENSXETP00000061042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]