SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061541 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061541
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-63
Family BAR domain 0.0000000195
Further Details:      
 
Domain Number 2 Region: 267-332
Classification Level Classification E-value
Superfamily SH3-domain 1.04e-22
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061541   Gene: ENSXETG00000018020   Transcript: ENSXETT00000060871
Sequence length 335
Comment pep:known scaffold:JGI_4.2:GL172798.1:1022154:1045014:-1 gene:ENSXETG00000018020 transcript:ENSXETT00000060871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKVSEKVGGAEGTKLDEDFKEMERKVDVTSRAVMEIMTKTTEYLQPNPASRAKLSMLNTM
SKIRGQEKGPGYPQAEALLAEAMFKFGREIGDESNFGLALIDVGDAMRELSDIKDCLDID
VKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKITDDEIRQALEKFDESK
EIAESSMFNLLEMDVNGETLYYFTIQNKIWGNSGVQQYILNIQDLFEYLIREASSQPRRE
YQPKPRMSLELENSQLNGGIALAGTPKPSGAPMDQPCCRALYDFDPENEGELGFKEGDII
TLTNQIDENWYEGMLHGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences F6TWF1
ENSXETP00000061541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]