SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061884 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061884
Domain Number 1 Region: 154-294
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.53e-25
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 30-148
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.21e-24
Family ADP-ribosylating toxins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061884   Gene: ENSXETG00000032410   Transcript: ENSXETT00000066184
Sequence length 303
Comment pep:novel scaffold:JGI_4.2:GL172675.1:3843588:3869175:1 gene:ENSXETG00000032410 transcript:ENSXETT00000066184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSVGIFESSLQKRAVINFSMHYKIILQSNAQPRDGKIYVMYHGTTLAAAIQIIQNGFKQS
ADGMLGRGVYVSRDMDKAARYPLRDQSQQVILKLRVNVGKVKMINYQGHPLQKTWHDHGY
DTAWVPASCGMVPSQLEEDCIWDPKRIKVVGIAKIFKENISEQYNHLFLQSNHHPRDRNI
YVMYHGTTVAAATQIIKHGFKQSADGMLGRGVYVSRDKDKAARYPLDDQSDQVVLKLRVN
VGRVKKIDCQGHPLQKTWHDHGYDTAWVPSCSGMVPSQLEEDCIWDPRRIKTLIKGDCVD
MKE
Download sequence
Identical sequences F6Q5H8
ENSXETP00000061884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]