SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062128 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062128
Domain Number 1 Region: 877-1164
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.42e-79
Family Complement components 0.0000254
Further Details:      
 
Domain Number 2 Region: 1318-1384
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.000000000209
Family Alpha-macroglobulin receptor domain 0.006
Further Details:      
 
Domain Number 3 Region: 714-796
Classification Level Classification E-value
Superfamily E set domains 0.0000000392
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062128   Gene: ENSXETG00000031004   Transcript: ENSXETT00000061484
Sequence length 1413
Comment pep:known_by_projection scaffold:JGI_4.2:GL172904.1:62042:119092:-1 gene:ENSXETG00000031004 transcript:ENSXETT00000061484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLITSPMDIRPGVNLTLGIEMLQESPPLVKVVAQLQKDEHTLLEGESFFKRGGFGTLVLP
QLPLNSVNGKYELNVKGYSEENLIFFNKTSLEFKSKGFSVFIETNSVFYKPGQEVKIRIL
AFSFHMKPYKSTVDIYILDPQGNLIEQWLEEEMELGVVSQSLYLSDNPPLGDWTIKVKLH
QQLHYQTFTVMEQVLPRFEVLLNTTLYHSIKNPHLEGTVTAKYTYGMPVKGKLSVMLSHN
SIYKKKTNITKDFVINGCARFSFSNVELKELMKNADYGSNKVTGPVDIDVNVKESLTGIT
QNVTTSVFVIDKEYNIEFLDHPTVLKPMLNFTIRLQIVRYDGRKLTAEERDNEVAVTVTQ
TRRDNSVELNATENESEDNVEMIQLTRYTVPKNGIICIEIPLLADIMHLYIKAEFLDAKN
NLFINDLFSSLNGTYIQIKKADQDLKVGTPYTLSVDGSFPLKDISYLVVSKGQIVAGGKG
NPKNITLNPENTWTPEVCLIVYHVANDGTVTNDVTAVSVQPIFENKVYISWNTTQARPAD
MVSLNVNVAEPNSLVVLSVIDKRVKLLGDRQEISTANVLKELKSYSTSHIQHYTNPSEVF
EMCNIGVMTDANIEVHDHFDIYIYHSEIDSQNAEKFVKRGFCSLYSFERNATDVTFPRIR
SLFPETWIWKHLKTGSTTHMTLDLKVPDVITTWITSAYVISENFGFGMLAPPEQLEAFQP
FFLSLNLPSYVIRGEQFVLEVIVFNYLQKETEVSVTLEKSDAFEIQLAFVNASESQQSVS
VPSQEGKIVFFPIKPIHLGEIPITVKAISALASDAVTQKLQVKAEGVQQSHSQTLLLDLM
GNKPKSISQTLNFTFPPDVVSGSEKAFITVVGDHLGLSIRSIKSLIQMPYGCGEQNMIRF
APNIFIMEYLSRTKQLNEDVAHKLISFIKNGYQRQLVYQREDGSFSAFGNKDPFGSTWLS
AFVLQCFLKARPFILVDPVVLHNTLTWLLKHQRKNGEFWEPGTVIYSQIQGGHHSAITLT
AYIMAALIEYPGLKNSSQVAAATDYLESQMDEIISDNYTLSLVTYALSLVGRSKATEGLD
LLNMRAEQEGQLRFWRSSISSCQHPCSTDIVISAYALLSYVVQNRIAEGMAVMKWLSQQR
SHLGGFSSTQDTIIALQAMSSFASVYTINKQILAITVDSHPLNSTATFQIDSNNRILLQT
KQLAVQQQMNLTVHAEGTGFAILQQFHTIYNLKNSVPGRYKSISSQDAFDLGITVLDNKD
NLNVVSLNICTSIVSSLRIQTRVAKTQKFGNYEAQKTSKSLQLMKKSIGEESFTYKSYTE
KLNQTEVCIDIPATRDFKVGYTQEAFVHVIDYYDPGQRAIRSYNSEVMQQVSPCSFCNDD
CNQCITGNHALRTEQTLFINYLFIILLLFQVML
Download sequence
Identical sequences F6TL90
ENSXETP00000059854 ENSXETP00000062128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]