SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062549 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062549
Domain Number 1 Region: 345-540
Classification Level Classification E-value
Superfamily Sec7 domain 8.11e-76
Family Sec7 domain 0.0000018
Further Details:      
 
Domain Number 2 Region: 102-285,798-813,844-1191
Classification Level Classification E-value
Superfamily ARM repeat 1.2e-27
Family PBS lyase HEAT-like repeat 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062549   Gene: ENSXETG00000031574   Transcript: ENSXETT00000061088
Sequence length 1505
Comment pep:known_by_projection scaffold:JGI_4.2:GL172780.1:424070:460992:-1 gene:ENSXETG00000031574 transcript:ENSXETT00000061088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCEESTQEVIQSIIQEMLNSVVGDKLEEETVRAECTARISEDPSDGDSIHANGIPGLPYL
SVCINKTQDKFCFPLSEGLIDVIELVGIVKKGYVGQCKFHSRSHELRSKVLSLQLLLSIL
QNAGPVFKTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKLHLKMQIE
VFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVN
DLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDLYVNPNSQTTLGQEK
PSEQDTHDTKHPETINRYGSLNSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQ
GIDLFNKKPKRGIQYLQEQGMLGTSPDDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMY
AYVDQHDFQGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTA
YVLAYSIIMLTTDLHSPQVKSKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISM
KETKELAITTKSSKPSVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEH
VRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFCIQLERDAYVQALA
RFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGSSWHEILKCISQLELAQLIGTGV
KPRYISGTVRNREGSFTGTKDQASDEFVSLGLVGGNVDWKQMASIQESIGETSSQSVVVA
VDRIFTGSTRLDGNAVVDFVRWLCAVSMDELLSPMHPRMFSLQKIVEISYYNMGRIRLQW
SRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIM
KRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHI
VTLVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEY
TSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWW
QDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYFEVLSDVLLDDIFAQ
LYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCMLDIFKTTIPHALLTWKP
AGGDTELSSQADGRDKQADSVSQKSVDIHESIQPRTADSRRNIQTQVSLVAQEEGHLARP
GARVAEQRLFAALLIKCVVQLELIQTIDNIVFFPATSRKEDAENLAAAQRDTVHLDVHVD
TQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTSLWKAGFKGKSKPNLLKQET
SSLACGLRILFRMYMDDSRSDAWDEVQHRLLNVCSEALSYFLTLTSESHREAWTNLLLLF
LTKVLKISDERFKAHASFYYPLLCEIIQFDLIPELRAILRRFFHRIGLVFKISIPQEQEP
QRVEE
Download sequence
Identical sequences F6V2F9
ENSXETP00000062549 ENSXETP00000062549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]