SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062630 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062630
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000101
Family C1 set domains (antibody constant domain-like) 0.0038
Further Details:      
 
Domain Number 2 Region: 245-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000436
Family C1 set domains (antibody constant domain-like) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000062630
Domain Number - Region: 151-215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0581
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062630   Gene: ENSXETG00000021436   Transcript: ENSXETT00000066457
Sequence length 356
Comment pep:novel scaffold:JGI_4.2:GL175102.1:5352:9625:-1 gene:ENSXETG00000021436 transcript:ENSXETT00000066457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVITDKESTLSATITGFYPVDLDVKWLRDGEILAGGTELTPQRNADGTYRVTSTVTIVPT
EGNQNFSIRVQHKSLSVPLQEDFPLIYGGNDGSLNCPTWILSISVTSYCCMGLLVTATPL
DILLYCRGDSFYQDFIIALYDSLEVLNCNLEADNFSPKEITISWEVAQPAGSAKYQPLGA
SPLMSANQDGSFNVTSTCEHLRDKVSGNEPFSLRATVQHGRLKQAVCKADLLSVPVMGEI
TRPTLYHNKEAALLCPISGFFPINLTVTWYKKEKEGQELTPLSPSEMYKIPEISPHKQED
KKFTVTASLVFSPSLTRDNGAEFICRVAHPSLEGAIEKSSGPIHVTLESLEIGVSP
Download sequence
Identical sequences F7C037
ENSXETP00000062630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]