SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063177 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063177
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 2 Region: 95-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000812
Family LDL receptor-like module 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000063177
Domain Number - Region: 130-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000524
Family LDL receptor-like module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063177   Gene: ENSXETG00000031890   Transcript: ENSXETT00000063404
Sequence length 172
Comment pep:known_by_projection scaffold:JGI_4.2:GL172637.1:6241222:6244448:-1 gene:ENSXETG00000031890 transcript:ENSXETT00000063404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCTRRCVCITVGVLLVLLGIALAIVFSVVFALPSQTPETRSCVTSNNYTGFLCDDRITCL
LPSQVCNSVNDCGNGEDETSSLCSNLPNNLPGYLIFRCGNPSNWIYSNLKCNEINNCGDC
SDESQSYASCPACGSQWWTCTPVLFQYCNCIPISLCQNGVQDCTDWSDEYVC
Download sequence
Identical sequences F7DWL5
ENSXETP00000063177 ENSXETP00000063177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]