SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000055 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000055
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.16e-23
Family Matrix metalloproteases, catalytic domain 0.0006
Further Details:      
 
Domain Number 2 Region: 167-244
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000342
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000055   Gene: ENSPTRG00000000035   Transcript: ENSPTRT00000000071
Sequence length 248
Comment pep:known chromosome:CHIMP2.1.4:1:1550242:1551706:1 gene:ENSPTRG00000000035 transcript:ENSPTRT00000000071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWL
TDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVC
ASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCG
QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTY
SWRVRVRG
Download sequence
Identical sequences ENSPTRP00000000055 ENSPTRP00000000055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]