SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000127 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000127
Domain Number 1 Region: 82-300
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4e-95
Family Caspase-activated DNase, CAD (DffB, DFF40) 0.0000000101
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.71e-25
Family CAD domain 0.00000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000127   Gene: ENSPTRG00000000070   Transcript: ENSPTRT00000000153
Sequence length 311
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:3671662:3699085:1 gene:ENSPTRG00000000070 transcript:ENSPTRT00000000153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYF
PSVPDNAELVLLTSGQAWQGYVSDIGRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQRLLA
DLLHNVSQNIAAETRAEDPPWFEVSSYPSTVGAEAQEEFLRVLGSMCQKLRSVQYNGSYF
DRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWNLDHIIEKKRT
IIPTLVEAIKEQDGREVDWEYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTR
LKRKRPVRKRQ
Download sequence
Identical sequences 9598.ENSPTRP00000000127 ENSPTRP00000000127 ENSPTRP00000000127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]