SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000271 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000271
Domain Number 1 Region: 423-684
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.41e-76
Family Eukaryotic proteases 0.00000000686
Further Details:      
 
Domain Number 2 Region: 26-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.000000486
Further Details:      
 
Domain Number 3 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-28
Family Spermadhesin, CUB domain 0.00000174
Further Details:      
 
Domain Number 4 Region: 366-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000653
Family Complement control module/SCR domain 0.00000673
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0000586
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000267
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000271   Gene: ENSPTRG00000000137   Transcript: ENSPTRT00000000314
Sequence length 686
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:11158885:11178561:-1 gene:ENSPTRG00000000137 transcript:ENSPTRT00000000314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTC
SALCSGQVFTQRSGDLSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETL
CPYDFLKIQTDREEYGPFCGKTLPHRIETKSNTMTITFVTDESGDHTGWKIHYTSTAQPC
PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDQPMPA
CSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLT
AAHAVYEQKHDASALDIRMGALKRLSPHYTQAWAEAVFIHEGYTHDAGFDNDIALIKLNN
KVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA
AYEKPPYPGGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETQRWFVGGIVSWGSMNC
GEAGQYGVYTKVINYIPWIENIISNF
Download sequence
Identical sequences H2PY01
XP_001135757.2.37143 XP_016809399.1.37143 ENSPTRP00000000271 ENSPTRP00000000271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]