SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000286 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000286
Domain Number 1 Region: 109-295
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-75
Family F-box associated region, FBA 0.0000000162
Further Details:      
 
Domain Number 2 Region: 42-139
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000249
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000286   Gene: ENSPTRG00000000146   Transcript: ENSPTRT00000000329
Sequence length 295
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:11792487:11798712:-1 gene:ENSPTRG00000000146 transcript:ENSPTRT00000000329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGDPESVGQPEEASPEEQPEEASAEEERLEDQEEEEAAAAAYLDELPEPLLLRVLAA
LPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRR
NLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQV
IDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAV
PQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences H2PY06
ENSPTRP00000000286 9598.ENSPTRP00000000286 ENSPTRP00000000286 XP_514389.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]