SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000287 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000287
Domain Number 1 Region: 75-258
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.53e-75
Family F-box associated region, FBA 0.00000164
Further Details:      
 
Domain Number 2 Region: 10-92
Classification Level Classification E-value
Superfamily F-box domain 7.33e-17
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000287   Gene: ENSPTRG00000000148   Transcript: ENSPTRT00000000335
Sequence length 293
Comment pep:known chromosome:CHIMP2.1.4:1:11808486:11820159:1 gene:ENSPTRG00000000148 transcript:ENSPTRT00000000335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLR
EGFITEDWDQPVANWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAH
GTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQ
YWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Download sequence
Identical sequences G2HE30
ENSPTRP00000000287 NP_001233333.1.37143 XP_009446436.1.37143 XP_009446446.1.37143 XP_009446457.1.37143 XP_009446462.1.37143 ENSPTRP00000000287 9598.ENSPTRP00000000287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]