SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000339 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000339
Domain Number 1 Region: 26-228
Classification Level Classification E-value
Superfamily L domain-like 2.04e-40
Family Ngr ectodomain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000339   Gene: ENSPTRG00000000182   Transcript: ENSPTRT00000000393
Sequence length 294
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:13545908:13586391:-1 gene:ENSPTRG00000000182 transcript:ENSPTRT00000000393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRAPACAAAALGLCSLLLLLAPGHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRK
LLVAGNRIQRIPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLG
AGAFRSAGRLVKLSLANNNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRS
LRLDGNPWLCDCDFAHLFSWIQENASKLPKGLDEIQCSLPMESRRISLRELSEASFSECR
FSLSLTDLFIIIFSGVAVSIAAIISSFFLATVVQCFQRCAPNKDAEDEDEDEDD
Download sequence
Identical sequences H2PY30
ENSPTRP00000000339 XP_513045.5.37143 ENSGGOP00000022509 ENSPTRP00000000339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]