SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000369 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000369
Domain Number 1 Region: 144-414
Classification Level Classification E-value
Superfamily Caspase-like 2.69e-91
Family Caspase catalytic domain 0.0000000000563
Further Details:      
 
Domain Number 2 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 1.51e-25
Family Caspase recruitment domain, CARD 0.00000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000369   Gene: ENSPTRG00000000200   Transcript: ENSPTRT00000000424
Sequence length 416
Comment pep:known chromosome:CHIMP2.1.4:1:15604694:15636888:-1 gene:ENSPTRG00000000200 transcript:ENSPTRT00000000424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKEMVLALLELARQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
Download sequence
Identical sequences H2PY35
ENSPTRP00000000369 ENSPTRP00000000369 XP_003806305.1.60992 XP_513049.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]