SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000586 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000586
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.85e-49
Family Hypothetical protein AT3g04780/F7O18 27 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000586   Gene: ENSPTRG00000000336   Transcript: ENSPTRT00000000661
Sequence length 211
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:23794176:23803881:1 gene:ENSPTRG00000000336 transcript:ENSPTRT00000000661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEE
RSDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTE
REPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELR
RHEVTICNYEASANPADHRVHQVTPQTHFIS
Download sequence
Identical sequences K7A701
ENSPTRP00000000586 9598.ENSPTRP00000000586 ENSPTRP00000000586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]