SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000810 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000810
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-27
Family Trypanosoma sialidase, C-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000810   Gene: ENSPTRG00000000464   Transcript: ENSPTRT00000000906
Sequence length 1524
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:31772808:31821688:-1 gene:ENSPTRG00000000464 transcript:ENSPTRT00000000906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAPVTQPTRRVFPRGLPEEFALVLTLLLKKHTHQKTWYLFQVTDANGYPQISLEVNSQER
SLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPM
RPVGHVFLGLDAEQGKPVSFDLQQVHIYCDPELVLEEGCCEILPAGCPPETSKARRDTQS
NELIEINPQSEGKVYTRCFCLEEPQNSQVDAQLTGRISQKAERGAKVEVGALPFQCPPCV
HGAWDSNVTLAPSGPKGGKGERGLPGPPGSKGEKGARGNDCVRISPDAPLQCAEGPKGEK
GESGALGPSGLPGSTGEKGQKGEKGDGGIKGVPGKPGRDGRPGEICVIGPKGQKGDPGFV
GPEGLAGEPGPPGLPGPPGMGLPGTPGDPGGPPGPKGDKGSSGIPGKEGPGGKPGKPGVK
GEKGDPCEVCPTLPEGFQNFVGLPGKPGPKGEPGDPVPARGDPGIQGIKGEKGEPCLSCS
SVVGAQHLVSSTGASGDVGSPGFGLPGLPGRAGVPGLKGEKGNFGEAGPAGSPGTPGPVG
PAGIKGAKGEPCEPCPALSNLQDGDVRVVALPGPSGEKGEPGPPGFGLPGKQGKAGERGL
KGQKGDAGNPGDPGTPGTTGRPGLSGEPGVRGPAGPKGEKGDGCTACPSLQGTVTDMAGR
PGQPGPKGEQGPEGVGRPGKPGQPGLPGVQGPPGLKGVQGEPGPPGRGVQGPQGEPGAPG
LPGIQGLPGPRGPPGPTGEKGAQGSPGVKGATGPVGPPGASVSGPPGRDGQQGQTGLRGT
PGEKGPRGEKGEPGECSCPSRGDLIFSGMPGAPGLWMGSSWQPGPQGPPGIPGPPGPPGV
PGLQGVPGNNGLPGQPGLTAELGSLPIEQHLLKSICGDCVQGQRAHPGYLVEKGEKGDQG
IPGVPGLDNCAQCFLSLERPRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGM
RGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGL
PGIKGERGYTGSAGEKGEPGPPGSEGLPGPPGPVGPRGERGPQGNSGEKGDQGFQGQPGF
PGPPGPPGFPGKVGSPGPPGPQAEKGSEGIRGPSGLPGSPGPPGPPGIQGPAGLDGLDGK
DGKPGLRGDPGPAGPPGLMGPPGFKGKTGHPGLPGPKGDCGKPGPPGSTGRPGAEGEPGA
TGPQGRPGPPGHVGPPGPPGQPGPAGISAVGLKGDRGATGERGLAGLPGQPGPPGHPGPP
GEPGTDGAAGKEGPPGKQGFYGPPGPKGDPGAAGQKGQAGEKGRAGMPGGPGKSGSMGPV
GPPGPAGERGHPGAPGPSGSPGLPGVPGSMGDMVNYDEIKRFIRQEIIKMFDERMAYYTS
RMQFPMEMAAAPGRPGPPGKDGAPGRPGAPGSPGLPGQIGREGRQGLPGVRGLPGTKGEK
GDIGIGIAGENGLPGPPGPQGPPGYGKMGATGPMGQQGIPGIPGPPGPMGQPGKAGHCNP
SDCFGAMPMEQQYPPMKTMKGPFG
Download sequence
Identical sequences ENSPTRP00000000810 ENSPTRP00000000810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]