SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001073 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001073
Domain Number 1 Region: 230-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-69
Family SPRY domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 38-146
Classification Level Classification E-value
Superfamily Immunoglobulin 8.56e-17
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001073   Gene: ENSPTRG00000000621   Transcript: ENSPTRT00000001184
Sequence length 475
Comment pep:known chromosome:CHIMP2.1.4:1:43145088:43162724:1 gene:ENSPTRG00000000621 transcript:ENSPTRT00000001184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMASSAGSWLSGCLIPLVFLRLSVHVSGRAGDAGKFHVALLGGTAELLCPLSLWPGTVP
KEVRWLRSPFPQRSQAVHVFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLED
QGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQR
RAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAV
TLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVG
DKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGI
FLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE
SIVPKPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Download sequence
Identical sequences K7B4S4
ENSPTRP00000001073 9598.ENSPTRP00000001073 ENSPTRP00000001073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]