SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001278 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001278
Domain Number 1 Region: 32-218
Classification Level Classification E-value
Superfamily HCP-like 1.05e-26
Family HCP-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001278   Gene: ENSPTRG00000000745   Transcript: ENSPTRT00000001408
Sequence length 231
Comment pep:known chromosome:CHIMP2.1.4:1:53112642:53124983:-1 gene:ENSPTRG00000000745 transcript:ENSPTRT00000001408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKF
NCEENQHSDSCYKLGAYYVTGKGGLTQDLKAAARCFLMACEKPGKKSIAACHNVGLLAHD
GQVNEDGQPDLGKARDYYTRACDGGYTSSCFNLSAMFLQGAPGFPKDMDLACKYSMKACD
LGHIWACANASRMYKLGDGVDKDEAKAEVLKNRAQQLHKEQQKGVQPLTFG
Download sequence
Identical sequences H2N7D6 H2PZ14 Q96BR5
ENSPPYP00000001562 ENSP00000360593 9598.ENSPTRP00000001278 9600.ENSPPYP00000001562 9606.ENSP00000360593 ENSPTRP00000001278 ENSPPYP00000001562 ENSPTRP00000001278 ENSP00000360593 gi|282396088|ref|NP_075565.2| ENSP00000360593 NP_001229523.1.37143 NP_075565.2.87134 NP_075565.2.92137 XP_002810862.1.23681 XP_003815078.2.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]