SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001283 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001283
Domain Number 1 Region: 113-495
Classification Level Classification E-value
Superfamily L domain-like 9.18e-54
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 427-634
Classification Level Classification E-value
Superfamily L domain-like 3.06e-33
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001283   Gene: ENSPTRG00000000749   Transcript: ENSPTRT00000001413
Sequence length 661
Comment pep:known chromosome:CHIMP2.1.4:1:53511309:53695762:1 gene:ENSPTRG00000000749 transcript:ENSPTRT00000001413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGARARGAQLRLGERVRPVGRRSAPGRSRFRQPWRPGASDSAPPAGTMAQSRVLLLLLL
LPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAVVSCPRDC
ACSQEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRL
TSRGLPEKAFEHLTNLNYLYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPN
LRSVYLHNNKLADAGLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEK
IPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLSRVPAGLPRSLV
LLHLEKNAIRSVDADVLTPIRSLEYLLLHSNQLRAQGIHPLAFQGLKRLHTVHLYNNALE
RVPSGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLL
RSLDLSGNRLHTLPPGLPRNVHVLKVKRNELAALARGALAGMAQLRELYLTSNRLRSRAL
GPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTPNLKGIF
LRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDVSKDRGRLGKEKEEEEEEEEEEEET
R
Download sequence
Identical sequences A0A2I3TRP8
ENSPTRP00000001283 9598.ENSPTRP00000001283 XP_003308152.1.37143 ENSPTRP00000001283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]