SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001313 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001313
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-33
Family APC10-like 0.00000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001313   Gene: ENSPTRG00000000762   Transcript: ENSPTRT00000001443
Sequence length 144
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:54382033:54407163:-1 gene:ENSPTRG00000000762 transcript:ENSPTRT00000001443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIE
RLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIL
SAFDHFASVHSVSAEGTVVSNLSS
Download sequence
Identical sequences H2PZ28
9598.ENSPTRP00000001313 ENSPTRP00000001313 ENSPTRP00000001313 XP_001149402.1.37143 XP_003815050.1.60992 XP_008966124.1.60992 XP_008966125.1.60992 XP_008966126.1.60992 XP_009456511.1.37143 XP_009456526.1.37143 XP_009456539.1.37143 XP_009456546.1.37143 XP_513418.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]