SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001557 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001557
Domain Number 1 Region: 141-322
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.08e-60
Family Brix domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001557   Gene: ENSPTRG00000000901   Transcript: ENSPTRT00000001707
Sequence length 349
Comment pep:known chromosome:CHIMP2.1.4:1:85205895:85225000:1 gene:ENSPTRG00000000901 transcript:ENSPTRT00000001707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAGDKSSSSGKKSLKRKAAAEELQEAAGAGDGATENGVQPPKAAAFPPGFSISEIKNK
QRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTIDNQRVYDETTVDPND
EEVAYDEATDEFASYFNKQTSPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLAL
KKIIPQCIARDFTDLIVINEDRKTPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPT
EHIPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFRSE
KKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL
Download sequence
Identical sequences H2PZA5 Q9H9Y2
ENSPTRP00000001557 9598.ENSPTRP00000001557 9606.ENSP00000359688 NP_079341.2.87134 NP_079341.2.92137 XP_003805327.1.60992 XP_524755.2.37143 ENSP00000359690 gi|145275210|ref|NP_079341.2| ENSP00000359688 ENSP00000359688 ENSPTRP00000001557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]