SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001581 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001581
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 227-272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000575
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000586
Family Fibronectin type I module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001581   Gene: ENSPTRG00000000916   Transcript: ENSPTRT00000001732
Sequence length 381
Comment pep:known chromosome:CHIMP2.1.4:1:86329184:86332384:1 gene:ENSPTRG00000000916 transcript:ENSPTRT00000001732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRIARALALVVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQL
NEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVSGQCCEEWVCDEDSIKDPMEDQDGLLG
KELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQCS
KTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVRFTY
AGCLSVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCEDGETFSKNVMMIQSCKCNYNCP
HANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences A5A6L1 K7BX24
ENSPTRP00000001581 9598.ENSPTRP00000001581 ENSPTRP00000001581 NP_001092023.1.37143 XP_003805344.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]