SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001624 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001624
Domain Number 1 Region: 424-780
Classification Level Classification E-value
Superfamily L domain-like 3.3e-50
Family Internalin LRR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001624   Gene: ENSPTRG00000000942   Transcript: ENSPTRT00000001779
Sequence length 803
Comment pep:known chromosome:CHIMP2.1.4:1:90443745:90472242:1 gene:ENSPTRG00000000942 transcript:ENSPTRT00000001779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPVTEFRQFSEQQPAFRVLKPWWDVFTDYLSVAMLMIGVFGCTLQVMQDKIICLPKRVQ
PAQNHSSLSNVSQAVASTTPLPPPKPSPANPITVEMKGLKTDLDLQQYSFINQMCYERAL
HWYAKYFPYLVLIHTLVFMLCSNFWFKFPGSSSKIEHFISILGKCFDSPWTTRALSEVSG
EDSEEKDNRKNNMNRSNTIQSGPEGSLVNSQSLKSIPEKFVVDKSTAGALDKKEGEQAKA
LFEKVKKFRLHVEEGDILYAMYVRQTVLKVIKFLIIIAYNSALVSKVQFTVDCNVDIQDM
TGYKNFSCNHTMAHLFSKLSFCYLCFVSIYGLTCLYTLYWLFYRSLREYSFEYVRQETGI
DDIPDVKNDFAFMLHMIDQYDPLYSKRFAVFLSEVSENKLKQLNLNNEWTPDKLRQKLQT
NAHNRLELPLIMLSGLPDTVFEITELQSLKLEIIKNVMIPATIAQLDNLQELSLHQCSVK
IHSAALSFLKENLKVLSVKFDDMRELPPWMYGLRNLEELYLVGSLSHDISRNVTLESLRD
LKSLKILSIKSNVSKIPQAVVDVSSHLQKMCIHNDGTKLVMLNNLKKMTNLTELELVHCD
LERIPHAVFSLLSLQELDLKENNLKSIEEIVSFQHLRKLTVLKLWHNSITYIPEHIKKLT
SLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVES
LPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRA
GLVVEDALFETLPSDVREQMKTE
Download sequence
Identical sequences A0A2I3HQM7 G3SFV9 H2PZD4
ENSNLEP00000012505 ENSNLEP00000012505 ENSGGOP00000026995 ENSPTRP00000001624 9598.ENSPTRP00000001624 ENSPTRP00000001624 ENSGGOP00000026995 gi|19923729|ref|NP_115646.2| NP_115646.2.87134 NP_115646.2.92137 XP_003260078.1.23891 XP_004026155.1.27298 XP_008958729.1.60992 XP_014201549.1.60992 XP_014201552.1.60992 XP_016777645.1.37143 XP_016777654.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]