SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002209 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002209
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000275
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002209   Gene: ENSPTRG00000001294   Transcript: ENSPTRT00000002407
Sequence length 92
Comment pep:known chromosome:CHIMP2.1.4:1:129919177:129927231:1 gene:ENSPTRG00000001294 transcript:ENSPTRT00000002407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLPGLLQRPDPGALSIAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR
PDNILEFAADYFTDPRLPNKIHIQLIKDKKAA
Download sequence
Identical sequences H2PZZ5
ENSPTRP00000002209 NP_001153238.1.37143 ENSPTRP00000002209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]