SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002213 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002213
Domain Number 1 Region: 35-369
Classification Level Classification E-value
Superfamily L domain-like 1.84e-60
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 419-503
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-20
Family I set domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002213   Gene: ENSPTRG00000001298   Transcript: ENSPTRT00000002411
Sequence length 593
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:129999037:130004853:-1 gene:ENSPTRG00000001298 transcript:ENSPTRT00000002411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAATAPKQAWPPWPPLLFLLLLPGGSGGSCPAVCDCTSQPQAVLCGHRQLEAVPGGLPL
DTELLDLSGNRLWGLQRGMLSRLSLLQELDLSYNQLSTLEPGAFHGLQSLLTLRLQGNRL
RIMGPGVFSGLSALTLLDLRLNQIVLFLDGAFGELGSLQKLEVGDNHLVFVAPGAFAGLA
KLSTLTLERCNLSTVPGLALARLPALVALRLRELDIGRLPAGALRGLGQLKELEIHLWPS
LEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLSQNPISAIPARRLSPLV
RLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPL
TCDCRLLWLLRLRRHLDFGTSPPACAGPHHVQGKSLKEFSDILPPGHFTCKPALIRKSGP
RWVIAEEGGHAVFSCSGDGDPAPTVSWMRPHGAWLGRAGRVRVLEDGTLEIRSVQLRDRG
AYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVPGIPGPFFLDSRGVAMVLAVGF
LPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF
Download sequence
Identical sequences H2PZZ8
ENSPTRP00000002213 9598.ENSPTRP00000002213 ENSPTRP00000002213 XP_003817280.1.60992 XP_524871.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]