SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002334 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002334
Domain Number 1 Region: 113-214
Classification Level Classification E-value
Superfamily Fibronectin type III 9.44e-35
Family Fibronectin type III 0.000000993
Further Details:      
 
Domain Number 2 Region: 215-309
Classification Level Classification E-value
Superfamily Fibronectin type III 3.37e-18
Family Fibronectin type III 0.000000968
Further Details:      
 
Domain Number 3 Region: 23-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000387
Family I set domains 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002334   Gene: ENSPTRG00000001383   Transcript: ENSPTRT00000002538
Sequence length 468
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:132656163:132724580:1 gene:ENSPTRG00000001383 transcript:ENSPTRT00000002538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSQTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPTQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Download sequence
Identical sequences ENSPTRP00000002334 XP_003817158.1.60992 XP_016783442.1.37143 9598.ENSPTRP00000002334 ENSPTRP00000002334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]