SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002377 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002377
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 545-612,648-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000182
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 425-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000782
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 25-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000278
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002377
Domain Number - Region: 266-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0471
Family Apolipoprotein A-I 0.019
Further Details:      
 
Domain Number - Region: 158-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0547
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002377   Gene: ENSPTRG00000001411   Transcript: ENSPTRT00000002585
Sequence length 759
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:133431177:133442551:1 gene:ENSPTRG00000001411 transcript:ENSPTRT00000002585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWG
ASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGK
ILLGSGASSNAGLTGRDGPTAGCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD
Download sequence
Identical sequences H2Q071 Q7Z4K8
ENSPTRP00000002377 ENSP00000357369 9598.ENSPTRP00000002377 9606.ENSP00000334657 ENSPTRP00000002377 NP_079334.3.87134 NP_079334.3.92137 XP_003817111.1.60992 XP_524895.1.37143 ENSP00000334657 gi|47174859|ref|NP_079334.3| ENSP00000334657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]