SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002388 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002388
Domain Number 1 Region: 724-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-104
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 597-722
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-34
Family TSP type-3 repeat 0.00000379
Further Details:      
 
Domain Number 3 Region: 516-599
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.14e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000109
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 445-540
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000824
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 6 Region: 53-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000135
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 7 Region: 316-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000111
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002388
Domain Number - Region: 363-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 278-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0384
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 416-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002388   Gene: ENSPTRG00000001413   Transcript: ENSPTRT00000002596
Sequence length 956
Comment pep:known chromosome:CHIMP2.1.4:1:133451143:133463489:-1 gene:ENSPTRG00000001413 transcript:ENSPTRT00000002596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCFFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences G3R1N5 H2Q073
XP_001154764.1.37143 XP_003817107.1.60992 XP_004026921.1.27298 ENSPTRP00000002388 ENSPTRP00000002388 9598.ENSPTRP00000002388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]