SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002450 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002450
Domain Number 1 Region: 65-99
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000000647
Family GLA-domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002450   Gene: ENSPTRG00000041553   Transcript: ENSPTRT00000002667
Sequence length 100
Comment pep:known chromosome:CHIMP2.1.4:1:134538438:134539538:1 gene:ENSPTRG00000041553 transcript:ENSPTRT00000002667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
VPYPDTLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Download sequence
Identical sequences P84348
NP_001129100.1.37143 XP_008972806.1.60992 XP_016784372.1.37143 ENSPTRP00000002450 ENSPTRP00000002450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]