SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002520 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002520
Domain Number 1 Region: 208-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000141
Family I set domains 0.038
Further Details:      
 
Domain Number 2 Region: 19-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000762
Family I set domains 0.0052
Further Details:      
 
Domain Number 3 Region: 296-386
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000102
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 107-198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000199
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002520   Gene: ENSPTRG00000001491   Transcript: ENSPTRT00000002745
Sequence length 508
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:136060563:136091969:-1 gene:ENSPTRG00000001491 transcript:ENSPTRT00000002745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSV
FKKFSDFLIQSAVLSDSGNYFCSTKGQLLFWDKTSNIVKIKVQELFQHPVLTASSFQPIE
GGPVSLKCETRRSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCEAE
TVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWY
REATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRP
VLTLRSPVAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTA
EHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTARVLWGLFGVLGFTGVALLLYA
LFHKISGESSATNEPRGASRPNPQEFTYSSPTPDMEELQPVYVNVGSVDVDVVYSQVWSM
QQPEGSANIRTLLENKDSQVIYSSVKKS
Download sequence
Identical sequences A0A2I3TP16
ENSPTRP00000002520 ENSPTRP00000002520 XP_524903.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]