SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002574 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002574
Domain Number 1 Region: 20-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-43
Family Pentraxin (pentaxin) 0.00000000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002574   Gene: ENSPTRG00000001527   Transcript: ENSPTRT00000002803
Sequence length 224
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:138045085:138047842:-1 gene:ENSPTRG00000001527 transcript:ENSPTRT00000002803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKGIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEESQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Download sequence
Identical sequences H2Q0D1
XP_001170732.2.37143 9598.ENSPTRP00000002574 ENSPTRP00000002574 ENSPTRP00000002574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]