SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002701 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002701
Domain Number 1 Region: 24-225
Classification Level Classification E-value
Superfamily L domain-like 1.6e-35
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002701   Gene: ENSPTRG00000001614   Transcript: ENSPTRT00000002941
Sequence length 313
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:143882698:143903435:1 gene:ENSPTRG00000001614 transcript:ENSPTRT00000002941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFL
NENRITSLPAMHLGLLSDLVYLDCQNNRIREVMDYTFIGVFKLIYLDLSSNNLTSISPFT
FSVLSNLVQLNIANNPHLLSLHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLF
LSGNPWKCNCSFLDFAIFLIVFHMDPSDDLNATCVEPTELTGWPITRVGNPLRYMCITHL
DHKDYIFLLLIGFCIFAAGTVAAWLTGVCAVLYQNTCHKSSEEDEDEAGTRVEVSRRIFQ
TQTSSVQEFPQLI
Download sequence
Identical sequences H2Q0I3
ENSPTRP00000002701 XP_524946.2.37143 9598.ENSPTRP00000002701 ENSPTRP00000002701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]