SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002764 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002764
Domain Number 1 Region: 39-156
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-31
Family C-type lectin domain 0.00000504
Further Details:      
 
Domain Number 2 Region: 252-318
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 197-262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 4 Region: 157-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002764   Gene: ENSPTRG00000001661   Transcript: ENSPTRT00000003012
Sequence length 372
Comment pep:known chromosome:CHIMP2.1.4:1:148088759:148109814:-1 gene:ENSPTRG00000001661 transcript:ENSPTRT00000003012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN
NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC
NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT
CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK
TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
GKKSKRSMDDPY
Download sequence
Identical sequences Q95237
ENSPTRP00000002764 NP_001009074.1.37143 ENSPTRP00000002764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]