SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002766 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002766
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-32
Family C-type lectin domain 0.000000623
Further Details:      
 
Domain Number 2 Region: 242-306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 180-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000012
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 302-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000121
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 366-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 423-490
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000389
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 488-549
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000751
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002766   Gene: ENSPTRG00000001662   Transcript: ENSPTRT00000003014
Sequence length 610
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:148120760:148132223:-1 gene:ENSPTRG00000001662 transcript:ENSPTRT00000003014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSVSCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVDCFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFGLKGSKRLQCGPTGEWDN
AKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAALTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
Download sequence
Identical sequences H2Q0K5
9598.ENSPTRP00000002766 XP_009436198.1.37143 ENSPTRP00000002766 ENSPTRP00000002766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]