SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002773 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002773
Domain Number 1 Region: 276-667
Classification Level Classification E-value
Superfamily ARM repeat 1.57e-47
Family Armadillo repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002773   Gene: ENSPTRG00000001666   Transcript: ENSPTRT00000003021
Sequence length 792
Comment pep:known chromosome:CHIMP2.1.4:1:148322293:148477470:-1 gene:ENSPTRG00000001666 transcript:ENSPTRT00000003021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGEDARYLKRKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKIIRLKS
LNANTDITSLARKVVEECKLIHPSKLNEVEQLLYYLQNRRDSLSGKEKKEKSSKPKDPPP
FEGMEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALA
RVLREDWKQSVELATNIIYIFFCFSSFSQFHGLITHYKIGALCMNIIDHELKRHELWQEE
LSKKKKAVDEDPENQTLRKDYEKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMR
NKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDL
LNITLRLLLNLSFDTGLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKSMF
AYTDCIPQLMKMLFECSDERIDLELISFCINLAANKRNVQLICEGNGLKMLMKRALKFKD
PLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWEL
VLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNA
QQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDII
AEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDL
FYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGF
RPDEPYYYGYGS
Download sequence
Identical sequences A0A2J8SAY1 G3RN71 H2Q0K8 Q92845
NP_055785.2.87134 NP_055785.2.92137 XP_003824684.1.60992 XP_004027924.1.27298 XP_513988.2.37143 ENSPTRP00000002773 ENSP00000354560 gi|18105054|ref|NP_055785.2| ENSGGOP00000017237 ENSP00000354560 HR3513 ENSP00000354560 ENSPTRP00000002773 9598.ENSPTRP00000002773 9606.ENSP00000354560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]