SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002784 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002784
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.44e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 
Domain Number 2 Region: 317-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000405
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002784   Gene: ENSPTRG00000001674   Transcript: ENSPTRT00000003032
Sequence length 532
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:149674649:149711926:1 gene:ENSPTRG00000001674 transcript:ENSPTRT00000003032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKSKVCSVTKCSDFA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLMDPHLALIVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
Download sequence
Identical sequences H2Q0L5
9598.ENSPTRP00000002784 XP_001142786.1.37143 XP_009436464.1.37143 ENSPTRP00000002784 ENSPTRP00000002784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]