SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002812 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002812
Domain Number 1 Region: 505-601
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000187
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002812
Domain Number - Region: 1087-1143
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0497
Family C-terminal domain of PLC-beta 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002812   Gene: ENSPTRG00000001689   Transcript: ENSPTRT00000003061
Sequence length 1406
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:150994493:151073746:1 gene:ENSPTRG00000001689 transcript:ENSPTRT00000003061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGFLARPFLSTNQHLAQWGSPLPQGKGLVQLPSQHTRHSRPFHELCSKEENSATVPKLI
SLVVSGETIDFSNNTMDSRRDWEREKRILEGKLQLPKALARTQRARDEGRRAWTSRWPQQ
RRSPESCEAPLSAPLWGPQRGLPGREPLRSRSASAIALRTIGHILALLLRLLHLGLGSGG
CREDVPPSGRGKKEEKMKKHRRALALVSCLFLCSLVWLPSWRVCCKESSSASASSYYSQD
DNCALENEDVQFQKKNTESKKLSPPVVETLPTVDLHEESSNAVVDSETVENISSSSTSEI
TPISKLDEIEKSGTIPIAKPSETEQSETDCDVGEALDASAPIEQPSFVSPPDSLVGQHIE
NVSSSHGKGKITKSEFESKVSASEQGGGDPKSALNASDNLKNESSDYTKPGDIDPTSVAS
PKDPEDIPTFDEWKKKVMEVEKEKSQSMHASSNGGSHATKKVQKNRNNYASVECGAKILA
ANPEAKSTSAILIENMDLYMLNPCSTKIWFVIELCEPIQVKQLDIANYELFSSTPKDFLV
SISDRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYVKVELLSHFGSEHFCPLSLIRV
FGTSMVEEYEEIADSQYHSERQELFDEDYDYPLDYNTGEDKSSKNLLGSATNAILNMVNI
AANILGAKTEDLTEGNKSISENATATAAPKMPESTPVSTPVPSPEYVTTEVHTHDMEPST
PDTPKESPIVQLVQEEEEEASPSTVTLLGSGEQEDESSPWFESETQIFCSELTTICCISS
FSEYIYKWCSVRVALYRQRSRTALSKGKDYLVSAQPPLLLPAESVDVSVLQPLSGELENK
NIEREAETVVLGDLSSSMHQDDLVNHTVDAVELEPSHSQTLSQSVLLDITPEINPLPKIE
VSESVEYETGHIPSQVIPQESSVEIDNETEQKSESFSSIEKPSITYETNKVNELMDNIIK
EDVNSMQIFTKLSETIVPPINTATVPDNEDGEAKMNIADTAKQTLISVVDSSSLPEVKEE
EQSPEDALLRGLQRTATDFYAELQNSTDLGYANGNLVHGSNQKESVFMRLNNRIKALEVN
MSLSGRYLEELSQRYRKQMEDFQKAFNKTIVKLQNTSRIAEEQDQRQTEAIQLLQAQLTN
MTQLVSNLSATVAELKREVSDRQSYLVISLVLCVVLGLMLCMQRCRNTSQFDGDYISKLP
KSNQYPSPKRCFSSYDDMNLKRRTSFPLMRSKSLQLTGKEVDPNDLYIVEPLKFSPEKKK
KRCKYKIEKIETIKPEEPLHPIANGDIKGRKPFTNQRDFSNMGEVYHSSYKGPPSEGSSE
TSSQSEESYFCGISACTSLCNGQSQKTKTEKRALKRRRSKVQDQGKLIKTLIQTKSGSLP
SLHDIIKGNKEITVGTFGVTAVSGHI
Download sequence
Identical sequences ENSPTRP00000002813 ENSPTRP00000002812 9598.ENSPTRP00000056607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]