SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002813 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002813
Domain Number 1 Region: 346-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000165
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002813
Domain Number - Region: 935-991
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0432
Family C-terminal domain of PLC-beta 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002813   Gene: ENSPTRG00000001689   Transcript: ENSPTRT00000003062
Sequence length 1254
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:150995144:151073746:1 gene:ENSPTRG00000001689 transcript:ENSPTRT00000003062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKHRRALALVSCLFLCSLVWLPSWRVCCKESSSASASSYYSQDDNCALENEDVQFQKKD
EREGPINAESLGKSGSNLPISPKEHKLKDDSIVDVQNTESKKLSPPVVETLPTVDLHEES
SNAVVDSETVENISSSSTSEITPISKLDEIEKSGTIPIAKPSETEQSETDCDVGEALDAS
APIEQPSFVSPPDSLVGQHIENVSSSHGKGKITKSEFESKVSASEQGGGDPKSALNASDN
LKNESSDYTKPGDIDPTSVASPKDPEDIPTFDEWKKKVMEVEKEKSQSMHASSNGGSHAT
KKVQKNRNNYASVECGAKILAANPEAKSTSAILIENMDLYMLNPCSTKIWFVIELCEPIQ
VKQLDIANYELFSSTPKDFLVSISDRYPTNKWIKLGTFHGRDERNVQSFPLDEQMYAKYV
KMFIKYIKVELLSHFGSEHFCPLSLIRVFGTSMVEEYEEIADSQYHSERQELFDEDYDYP
LDYNTGEDKSSKNLLGSATNAILNMVNIAANILGAKTEDLTEGNKSISENATATAAPKMP
ESTPVSTPVPSPEYVTTEVHTHDMEPSTPDTPKESPIVQLVQEEEEEASPSTVTLLGSGE
QEDESSPWFESETQIFCSELTTICCISSFSEYIYKWCSVRVALYRQRSRTALSKGKDYLV
SAQPPLLLPAESVDVSVLQPLSGELENKNIEREAETVVLGDLSSSMHQDDLVNHTVDAVE
LEPSHSQTLSQSVLLDITPEINPLPKIEVSESVEYETGHIPSQVIPQESSVEIDNETEQK
SESFSSIEKPSITYETNKVNELMDNIIKEDVNSMQIFTKLSETIVPPINTATVPDNEDGE
AKMNIADTAKQTLISVVDSSSLPEVKEEEQSPEDALLRGLQRTATDFYAELQNSTDLGYA
NGNLVHGSNQKESVFMRLNNRIKALEVNMSLSGRYLEELSQRYRKQMEDFQKAFNKTIVK
LQNTSRIAEEQDQRQTEAIQLLQAQLTNMTQLVSNLSATVAELKREVSDRQSYLVISLVL
CVVLGLMLCMQRCRNTSQFDGDYISKLPKSNQYPSPKRCFSSYDDMNLKRRTSFPLMRSK
SLQLTGKEVDPNDLYIVEPLKFSPEKKKKRCKYKIEKIETIKPEEPLHPIANGDIKGRKP
FTNQRDFSNMGEVYHSSYKGPPSEGSSETSSQSEESYFCGISACTSLCNGQSQKTKTEKR
ALKRRRSKVQDQGKLIKTLIQTKSGSLPSLHDIIKGNKEITVGTFGVTAVSGHI
Download sequence
Identical sequences ENSPTRP00000002813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]