SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002840 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002840
Domain Number 1 Region: 1057-1278
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.83e-81
Family Fibrinogen C-terminal domain-like 0.00000158
Further Details:      
 
Domain Number 2 Region: 709-872
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-21
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 3 Region: 444-604
Classification Level Classification E-value
Superfamily Fibronectin type III 4.01e-20
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 887-1047
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 5 Region: 619-706
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-18
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 6 Region: 265-424
Classification Level Classification E-value
Superfamily Fibronectin type III 6.63e-18
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002840
Domain Number - Region: 237-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 174-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 205-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0162
Family Integrin beta EGF-like domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002840   Gene: ENSPTRG00000001707   Transcript: ENSPTRT00000003089
Sequence length 1299
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:153567634:153647719:1 gene:ENSPTRG00000001707 transcript:ENSPTRT00000003089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQEMFRFPMGLLLGSVLLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDA
DPQPLSDNGASLLALGEAGEEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMV
EMKEQCSAQRCCQGVTDLSRHCSGHGTFSLETCSCHCEEGREGPACERLACPGACSGHGR
CVDGRCLCHEPYVGADCSYPACPVNCSGHGECVHGVCQCHEDFMSEDCSEKRCPGDCSGH
GFCDTGECYCEEGFTGLDCAQVVTPQGLQLLKNTEDSLLVSWEPSSQVDHYLLSYYPLGK
DLSGKQIQVPKEQHSYEIPGLLPGTKYIVTLRNVKKEVSSSPQHLLATTDLAVLGTAWVT
DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDITGLHPGTEYK
ITVVPMRGELEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWDPVQAVIDKYVVRYTSA
DGDAKEMAVHKDESSTVLMGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
RVTENTATISWDPVQATIDKYVVRYTSGDDQETREVLVGKEQSSTVLTGLRPGVEYTVHV
WAQKGDRESKKADTNALTDIDSPKNLVTDRVTENMATVSWDPVQAAIDKYMVRYTSADGE
TREVPVGKEQSSTVLTGLRPGMEYMVHVWAQKGDQESKKADTKAQTDIDSPQNLVTDRVT
ENMATVSWDPVRATIDRYVVHYTSAKDGETREVPVGKEQSSTVLTGLRPGVEYTVHVWAQ
KGVQESKKADTKAQTDIDSPQNLVTDRVTENTATVSWDPVQATIDRYVVRYTSANGETRE
VPVGKEQSSTVLTGLRPGVEYTVHVWAQKGNQESKKADTKAQTEIDSPKNLVTDWVTENM
ATVSWDLVQATIDKYMVRYTSADGETREVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGAQ
ESKKADTKAQTELDPPRNLRPSAVTQSGGILTWTPPSAQIHGYILTYQFPDGTVKEMQLG
REDQRFELQGLEQGATYPVSLVAFKGGRRSRNVSTTLSTVGARFPHPSDCSQVQQNSNAA
SGLYTIYLHGDASRPLQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEF
WLGLDKLHNLTTGTPARYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
ALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
KGHEFSIPYVELKIRPHGYSREPVLGRKKRTLRGRLRTF
Download sequence
Identical sequences ENSPTRP00000002840 ENSPTRP00000002840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]