SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002849 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002849
Domain Number 1 Region: 212-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-30
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 2 Region: 682-829
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000242
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1524-1598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000138
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1590-1647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000514
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number 5 Region: 540-631,720-771
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000586
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 6 Region: 1469-1530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000128
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 7 Region: 837-879,1063-1107
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000283
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002849
Domain Number - Region: 1417-1467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00393
Family Complement control module/SCR domain 0.008
Further Details:      
 
Domain Number - Region: 1728-1758
Classification Level Classification E-value
Superfamily Notch domain 0.0235
Family Notch domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002849   Gene: ENSPTRG00000001712   Transcript: ENSPTRT00000003099
Sequence length 1791
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:154972685:155362424:1 gene:ENSPTRG00000001712 transcript:ENSPTRT00000003099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCLKILRISLAILAGWALCSANSELGWTRKKSLVEREHLNQVLLEGERCWLGAKVRRPR
ASPQHHLFGVYPSRAGNYLRPYPVGEQEIHHTGRSKPDTEGNAVSLVPPDLTENPAKKRG
AVEQPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTL
NEPKPETQRRGWAKSRQRRQVWKRRAEDVQGDSGISSHFQPWPKHSLKHRVKKSPPEESN
QNGGEGSYREAETFNSQVGLPILYFSGRRERLLLRPEVLAEIPREAFTVEAWVKPEGGQN
NPAIIAGVFDNCSHTVSDKGWALGIRSGKDKGKQDARFFFSLCTDRVKKATILISHSRYQ
PGTWTHVAATYDGRHMALYVDGTQVASSLDQSGPLNSPFMASCRSLLLGGDSSEDGHYFR
GHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEV
LQGFEPEPEILSPLQPPLCGQTVCDNVELISQYNGYWPLRGEKVIRYQVVNICDDEGLNP
IVSEEQIRLQHEALNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPQVADVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNIYFASSVREDLAGAATWPWDKDAVTHLGGIVLSPA
YYGMPGHTDTMIHEVGHVLGLYHVFKGVSERESCNDPCKETVPSMETGDLCADTAPTPKS
ELCREPEPTSDTCGFTRFPGAPFTNYMSYTDDNCTDNFTPNQVARMHCYLDLVYQQWTES
RKPTPIPIPPMVIGQTNKSLTIHWLPPISGVVYDRASGSLCGACTEDGTFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPEVHLYHMNMTVPCPTEGCSLELLFQHP
VQADTLTLWVTSFFMESSQVLFDTEILLENKESVHLGPLDTFCDIPLTIKLHVDGKVSGV
KVYTFDERIEIDAALLTSQPHSPLCSGCRPVRYQVLRDPPFASGLPVVVTHSHRKFTDVE
VTPGQMYQYQVLAEAGGELGEASPPLNHIHGAPYCGDGKVSERLGEECDDGDLVSGDGCS
KVCELEEGFNCVGEPSLCYMYEGDGICEPFERKTSIVDCGIYTPKGYLDQWATQAYSSHE
DKKKCPVSLVTGEPHSLICTSYHPDLPNHRPLTGWFPCVASENETQDDRSEQPEGSLKKE
DEVWLKVCFNRPGEARAIFIFLTTDGLVPGEHQQPTVTLYLTDVRGSNHSLGTYGLSCQH
NPLIINVTHHQNVLFHHTTSVLLNFSSPWVGISAVALRTFSRVGLSAPSNCISEDEGQNH
QGQSCIHRPCGKQDSCPSLLLDHADVVNCTSIGPGLMKCAITCQRGFALQASSGQYIRPM
QKEILLTCSSGHWDQNVSCLPVDCGVPDPSLVNYANFSCSEGTKFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPEVYCKLECDAPPVILNANLLLPHCLQDNHDVGTICKYECKPGY
YVAESAEGKVRNKLLKIQCLEGGIWEQGSCIPVVCEPPPPVFEGMYECTNGFSLDSQCVL
NCNQEREKLPILCTKEGLWTQEFKLCENLQGECPPPPSELNSVEYKCEQGYGIGAVCSPL
CVIPPSDPVMLPENITADTLEHWMEPVKVQSIVCTGRRQWHPDPVLVHCIQSCEPFQADG
WCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences ENSPTRP00000002849 9598.ENSPTRP00000002849 ENSPTRP00000002849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]