SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003004 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003004
Domain Number 1 Region: 87-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000236
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 22-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000542
Family Complement control module/SCR domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003004   Gene: ENSPTRG00000001800   Transcript: ENSPTRT00000003266
Sequence length 177
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:175489669:175504741:1 gene:ENSPTRG00000001800 transcript:ENSPTRT00000003266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLINVILTLWVSCANGQVKPCDFPDIKHGGLFHENMRRPHFPVAVGKYYSYYCDEHFE
TPSGSYWDYIHCTQNGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYRL
PKAQTTVTCTEKGWSPTPRCIRVNPCIITENMNNNITFKGRNEIYYANRDTEFCLGY
Download sequence
Identical sequences ENSPTRP00000003004 ENSPTRP00000003004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]