SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003008 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003008
Domain Number 1 Region: 394-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.09e-18
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 2 Region: 210-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000249
Family Complement control module/SCR domain 0.00071
Further Details:      
 
Domain Number 3 Region: 94-151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000498
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 340-395
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000127
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 146-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000195
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 6 Region: 269-334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000347
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 7 Region: 22-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000361
Family Complement control module/SCR domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003008   Gene: ENSPTRG00000001801   Transcript: ENSPTRT00000003270
Sequence length 458
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:175597111:175627003:1 gene:ENSPTRG00000001801 transcript:ENSPTRT00000003270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLINVILTLWVSCANGQVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNFV
TPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDVEIENGFISESSSIYILNEETQYNCKPGY
ATADGNSSGSITCLQNGWSTQPICIKFCDMPVFENSRAKSNGMWFKLHDTLDYECYDGYE
SSYGNTTDSIVCGEDGWSHLPTCYNSSENCGPPPPISNGDTTSFPQKVYLPWSRVEYQCQ
SYYELQGSKYVTCSNGEWSEPPRCISMKPCEFPEIQHGHLYYENMRRLYFPVATGQSYSY
YCDKNFVTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDIEIENGFISEYSSIYILNKEIQ
YKCKPGYATADGNSSGSITCLQNGWSTQPICINPCIITEKNMNKNNIKLKGRNDRKYYAK
TGDTIEFMCKLGYNANTSILSFQAVCREGIVEYPRCEQ
Download sequence
Identical sequences ENSPTRP00000003008 ENSPTRP00000003008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]